DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and PHS1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_851066.2 Gene:PHS1 / 832437 AraportID:AT5G23720 Length:929 Species:Arabidopsis thaliana


Alignment Length:211 Identity:69/211 - (32%)
Similarity:98/211 - (46%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNK 89
            |:...|||       ..|:|:...|.|.:...|.:              :...::||...||::.
plant   679 YELKVRLE-------HILERISLISKAANTEKPSM--------------IQENLFIGGGLAARSI 722

  Fly    90 TYLRLMGITHVLNAAEGC----RYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDIS 150
            ..|:.:||||||     |    ..||.||   .|.|:           |.|..|.:.|...::|.
plant   723 YTLQHLGITHVL-----CLCANEIGQSDT---QYPDL-----------FEYQNFSITDDEDSNIE 768

  Fly   151 RYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVR-MRRDIRPND 214
            ..|..|..||.....:||||||||..|.|||||.||||||:.:|::.::|...:| :.|..:|||
plant   769 SIFQEALDFIKHGEETGGKILVHCFEGRSRSATVVLAYLMLQKKLTLLEAWSKLRKVHRRAQPND 833

  Fly   215 GFLQQLADLDMELKRK 230
            ||.:.|.:||.:...|
plant   834 GFARILINLDKKCHGK 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 59/160 (37%)
PHS1NP_851066.2 Act-Frag_cataly 111..426 CDD:370352
DSP 704..841 CDD:350348 58/169 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.