DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DSPTP1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001189955.1 Gene:DSPTP1 / 821941 AraportID:AT3G23610 Length:228 Species:Arabidopsis thaliana


Alignment Length:199 Identity:63/199 - (31%)
Similarity:93/199 - (46%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SMAPSRALPGLRR--------AECAIHDVDCDEVY----------PGIYIGDAAAAKNKTYLRLM 95
            |.:.|.:|||:.:        .:..:..:.....|          .|:|:|..|||.||..|:..
plant    11 SSSSSSSLPGIEKYNEKVKNQIQALVRVIKVARTYRDDNVPSLIEQGLYLGSVAAASNKNVLKSY 75

  Fly    96 GITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFI 160
            .:||:|..|.                  |:|.:|.| .|.|....:||...|::..||.....||
plant    76 NVTHILTVAS------------------SLRPAHPD-DFVYKVVRVVDKEDTNLEMYFDECVDFI 121

  Fly   161 DSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDI-RPNDGFLQQLADLD 224
            |.|...||.:||||.||.|||.|.|:||||....|:...|::.|:.:|.: .||.||::||.||:
plant   122 DEAKRQGGSVLVHCFVGKSRSVTIVVAYLMKKHGMTLAQALQHVKSKRPVASPNAGFIRQLQDLE 186

  Fly   225 MELK 228
            ..::
plant   187 KSMQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 58/166 (35%)
DSPTP1NP_001189955.1 DSPc 51..186 CDD:238073 56/153 (37%)
CDC14 53..191 CDD:225297 57/157 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.