DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and LSF2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_566383.1 Gene:LSF2 / 820265 AraportID:AT3G10940 Length:282 Species:Arabidopsis thaliana


Alignment Length:124 Identity:33/124 - (26%)
Similarity:55/124 - (44%) Gaps:9/124 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ITHVLNAAEGCRYGQVDTGHSYYR-DMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFI 160
            :.::||.       |.|....|:. |:.||.|..|:...|:|..|..|.....:......|...:
plant   121 VAYILNL-------QQDKDIEYWGIDLDSIVRRCKELGIRHMRRPAKDFDPLSLRSQLPKAVSSL 178

  Fly   161 DSAISSG-GKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQ 218
            :.|:|.| |::.|||..|:.|:....:||:.....|:...|..|:..:|...||.|.::
plant   179 EWAVSEGKGRVYVHCSAGLGRAPGVSIAYMYWFCDMNLNTAYDTLVSKRPCGPNKGAIR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 33/124 (27%)
LSF2NP_566383.1 DSP_laforin-like 91..238 CDD:350375 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.