DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and MKP2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001189821.1 Gene:MKP2 / 819784 AraportID:AT3G06110 Length:167 Species:Arabidopsis thaliana


Alignment Length:160 Identity:62/160 - (38%)
Similarity:78/160 - (48%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVF 134
            |..|:..|::||..|.|.||.:|:...|||||..|       |.....|..|            |
plant    24 DLSEIQQGLFIGSVAEANNKDFLKSSNITHVLTVA-------VALAPPYPDD------------F 69

  Fly   135 RYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVD 199
            .|....:||...||::.||.....|||.||.|||.:||||.:|||||.|.|:||||....|....
plant    70 VYKVIEVVDRSETDLTVYFDECYSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAYLMKKHGMGFSK 134

  Fly   200 AIRTVRMRR-DIRPNDGFLQQLADLDMELK 228
            |:..||.|| ...||.||:.||...:..::
plant   135 AMELVRSRRHQAYPNPGFISQLQQFEKSIQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 61/156 (39%)
MKP2NP_001189821.1 DSP 26..158 CDD:350348 61/150 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.