DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and IBR5

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_178534.2 Gene:IBR5 / 814997 AraportID:AT2G04550 Length:257 Species:Arabidopsis thaliana


Alignment Length:182 Identity:49/182 - (26%)
Similarity:70/182 - (38%) Gaps:48/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYG 110
            :|.|..||..||..                  :|:|....|.....|:..||:.|||....|:  
plant    44 VHVSAFPSEILPEF------------------LYLGSYDNASRSELLKTQGISRVLNTVPMCQ-- 88

  Fly   111 QVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCL 175
                  :.||:.           |.|.|.      ..:....|..|.||:|.......::||||:
plant    89 ------NLYRNS-----------FTYHGL------DNEKVLQFDDAIKFLDQCEKDKARVLVHCM 130

  Fly   176 VGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR---DIRPNDGFLQQLADLD 224
            .|.|||...|:||||..:.....::.:.|:.||   ||.|.  |.|||.:.:
plant   131 SGKSRSPAVVVAYLMKRKGWRLAESHQWVKQRRPSTDISPE--FYQQLQEFE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 43/157 (27%)
IBR5NP_178534.2 DSPc 50..180 CDD:238073 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.