DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp12

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_075662.2 Gene:Dusp12 / 80915 MGIID:1890614 Length:339 Species:Mus musculus


Alignment Length:175 Identity:56/175 - (32%)
Similarity:81/175 - (46%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RALPGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSY 118
            |..|....|..|.|.|   ||.||:|:|.|||.....:||..|||.||.         ||:..::
Mouse    13 RQAPTASPASSAGHAV---EVRPGLYLGGAAAVAEPGHLREAGITAVLT---------VDSEPAF 65

  Fly   119 -----YRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGM 178
                 :..:            |.:..|.:|.|.||:..:......||..|.|.|..:||||..|:
Mouse    66 PAGAGFEGL------------RSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGV 118

  Fly   179 SRSATCVLAYLMICRKMS---AVDAIRTVRMRRDIRPNDGFLQQL 220
            |||...|:|::|...:::   |.|.:|||  :.:.:.|:||..||
Mouse   119 SRSVAVVMAFIMKTDQLTFEKAYDILRTV--KPEAKVNEGFEWQL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 50/158 (32%)
Dusp12NP_075662.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 3/11 (27%)
DSPc 26..165 CDD:238073 52/162 (32%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9UNI6 115..120 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.