DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP26

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001292044.1 Gene:DUSP26 / 78986 HGNCID:28161 Length:211 Species:Homo sapiens


Alignment Length:231 Identity:85/231 - (36%)
Similarity:123/231 - (53%) Gaps:31/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SWRYALLTDRYSSSIGDRYSPHYYQSPSRLETSEQTTGRQLQRVLH--YSMAPSRALPGLRRAEC 64
            :|.:|.:|          :...:.:|.||.....:.|..::..|.|  .::.....|....:..|
Human     5 NWLWASMT----------FMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTAC 59

  Fly    65 AIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSH 129
            .    ..|||:||:|:||...|.|:..||.:||||||||:           ||.:|..|   .::
Human    60 N----HADEVWPGLYLGDQDMANNRRELRRLGITHVLNAS-----------HSRWRGTP---EAY 106

  Fly   130 KDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISS-GGKILVHCLVGMSRSATCVLAYLMICR 193
            :....||:|....|:|..|:|.:|..|:.||..|:|. ||||||||.||:|||||.||||||:..
Human   107 EGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYH 171

  Fly   194 KMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMELKR 229
            .::.|:||:.|:..|.|.||.|||:||..||..|::
Human   172 HLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 73/156 (47%)
DUSP26NP_001292044.1 DUSP26 62..205 CDD:350426 73/156 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5579
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11421
Inparanoid 1 1.050 135 1.000 Inparanoid score I4582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm41148
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.