DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp14

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_012809590.1 Gene:dusp14 / 779639 XenbaseID:XB-GENE-1018339 Length:219 Species:Xenopus tropicalis


Alignment Length:162 Identity:50/162 - (30%)
Similarity:84/162 - (51%) Gaps:24/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYI--GDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFR 135
            ::.|.:|:  |:||.:::..|.|  .:|.::||.       ::..:|.:.|:.            
 Frog    49 QISPCLYLSSGNAAGSRHLVYSR--NVTCIVNAT-------LEIPNSNWPDVD------------ 92

  Fly   136 YMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDA 200
            |:..|:.|.|...::.||...:..|.......|:.||||:.|:|||||..:||||...:::.:||
 Frog    93 YIKVPVPDLPHAPLALYFDTVADRIHQNGKRNGRTLVHCVAGVSRSATLCIAYLMKYHRLALLDA 157

  Fly   201 IRTVRMRRD-IRPNDGFLQQLADLDMELKRKN 231
            .:.|:.||. :|||.||.|||...:.:|..||
 Frog   158 YQWVKTRRPVVRPNMGFWQQLIQYEKKLFGKN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/156 (30%)
dusp14XP_012809590.1 PTP_DSP_cys 47..189 CDD:421693 48/160 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.