DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Styxl1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_017176632.1 Gene:Styxl1 / 76571 MGIID:1923821 Length:347 Species:Mus musculus


Alignment Length:265 Identity:58/265 - (21%)
Similarity:94/265 - (35%) Gaps:79/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYALLTDRYSSS--------IGDRYSPHYYQSPSRLETSEQTTGRQL---QRVLHYSMAPSRALP 57
            ||.::.|..:||        :.:.......:...:.|.:|...|..:   |.::|::..|...|.
Mouse    88 RYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEFGQILIHFTRQPVYVLR 152

  Fly    58 GLRRAEC---AIH------------DVDCDEVYP------GIYIGDAAAAKN-KTYLRLMGITHV 100
            |  ..||   ..|            ::|..:.||      .:|:|..:.|.| |.:..|....||
Mouse   153 G--GYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHV 215

  Fly   101 LNAAEGCRY--GQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSA 163
            ..:.|...|  |..|                     :.:...:.|:|.|.:..||.....||:..
Mouse   216 NISMETTPYFIGNAD---------------------KLLHIKLEDSPDTLLFDYFRHICHFIELH 259

  Fly   164 ISSGGKILVHCLVGMSRSATCVLAYLM----------------IC--RKM---SAVDAIRTVRMR 207
            :.....:||....|:|||...|:|.||                .|  .||   |:||.|:|:...
Mouse   260 LRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKSRVPARGWSCPPEKMSLPSSVDRIKTIPHG 324

  Fly   208 RDIRP 212
            :.:||
Mouse   325 QTLRP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 41/172 (24%)
Styxl1XP_017176632.1 PTP_DSP_cys 174..>294 CDD:391942 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.