DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp10

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001099204.1 Gene:Dusp10 / 63995 RGDID:1310844 Length:482 Species:Rattus norvegicus


Alignment Length:207 Identity:56/207 - (27%)
Similarity:98/207 - (47%) Gaps:27/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LETSEQTTGR------QLQRVLHYSMAPSRALPGLRRAECAIHDVDCDE---VYPGIYIGDAAAA 86
            |.:.:|..|.      |||.........|.|...|.::..:..|::..|   :.|.:::|:...|
  Rat   273 LSSFKQNHGNLCDNSLQLQECREVGGGASAASSVLPQSVPSTPDIESAELTPILPFLFLGNEQDA 337

  Fly    87 KNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISR 151
            ::...::.:.:.:|:|         |.|....|.        ::..:|.|...|..|:...::.:
  Rat   338 QDLDAMQRLNVGYVIN---------VTTHLPLYH--------YEKGLFNYKRLPATDSNKQNLRQ 385

  Fly   152 YFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDG 215
            ||..|.:||:.|...|..:|:||..|:|||||.|:||||...:|:..||.:.|:.:|. |.||..
  Rat   386 YFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLN 450

  Fly   216 FLQQLADLDMEL 227
            |:.||.:.:.:|
  Rat   451 FMGQLLEFEEDL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 45/159 (28%)
Dusp10NP_001099204.1 DSP_MapKP 149..284 CDD:238723 3/10 (30%)
DSP_DUSP10 322..473 CDD:350415 45/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.