DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp4

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_071535.1 Gene:Dusp4 / 60587 RGDID:620625 Length:395 Species:Rattus norvegicus


Alignment Length:156 Identity:51/156 - (32%)
Similarity:79/156 - (50%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            |:.|.:|:|.|..|..:..|..:|||.:||.:..|               |:....|    ::|.
  Rat   199 EILPFLYLGSAYHAARRDMLDALGITALLNVSSDC---------------PNHFEGH----YQYK 244

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            ..|:.|....|||.:|..|.::||:.....|::||||..|:|||||..|||||:.:::...:|..
  Rat   245 CIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFE 309

  Fly   203 TVRMRRD-IRPNDGFLQQLADLDMEL 227
            .|:.||. |.||..|:.||...:.::
  Rat   310 FVKQRRSIISPNFSFMGQLLQFESQV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/154 (33%)
Dusp4NP_071535.1 DSP_MapKP 9..159 CDD:238723
DSPc 196..332 CDD:238073 51/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.