DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp12

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001020348.1 Gene:dusp12 / 573998 ZFINID:ZDB-GENE-050626-91 Length:305 Species:Danio rerio


Alignment Length:164 Identity:48/164 - (29%)
Similarity:71/164 - (43%) Gaps:39/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVD------TGHSYYRDMPSIRRSHKDC 132
            |..|:|||..:..|:...|...||||:|.         ||      ||                 
Zfish     4 VASGLYIGSVSDLKDAESLSAAGITHILT---------VDSEEASVTG----------------- 42

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISS-----GGKILVHCLVGMSRSATCVLAYLMIC 192
             |.......:|..:||:.......:.||..|:|:     ...:||||.||.||||..|.||||..
Zfish    43 -FNTKFIRALDDESTDLLSRLDDCTSFISEALSTQADSKSAAVLVHCHVGQSRSAAVVTAYLMKT 106

  Fly   193 RKMSAVDAIRTVR-MRRDIRPNDGFLQQLADLDM 225
            :.::..:|...:: ::.|::.|:.||.|||..|:
Zfish   107 QHLTLQEAYSKLQNIKPDVKMNEEFLDQLALYDL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 48/164 (29%)
dusp12NP_001020348.1 DSPc 4..139 CDD:238073 47/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.