DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp13a

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001103865.1 Gene:dusp13a / 568887 ZFINID:ZDB-GENE-080204-69 Length:189 Species:Danio rerio


Alignment Length:214 Identity:83/214 - (38%)
Similarity:116/214 - (54%) Gaps:39/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNK 89
            |::||..|         ||..|.....|:..:               :.|:|.:|||:..||::|
Zfish    10 YETPSVAE---------LQNFLLADRRPTGHV---------------NHVWPNVYIGNEVAARDK 50

  Fly    90 TYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFY 154
            ..|..|||||::|||.|..:  |:||..:||||.          ..|.|....|:....||.:||
Zfish    51 PMLYNMGITHIVNAASGPPH--VNTGPRFYRDMN----------IDYYGVEADDSFDFAISGFFY 103

  Fly   155 VASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQ 219
            ..::||.:|:|..|::.||||:|:|||||.|||:||||..::.::||:.||..|||.||.|||.|
Zfish   104 ATARFIRAALSKNGRVFVHCLMGVSRSATLVLAFLMICEDLTLMEAIKAVRQHRDICPNPGFLNQ 168

  Fly   220 LADLDMEL---KRKNLYPY 235
            |..|||.|   ::|.|..|
Zfish   169 LRHLDMRLVRERKKKLEAY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 71/155 (46%)
dusp13aNP_001103865.1 DSPc 31..173 CDD:238073 68/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5587
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4537
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm25024
orthoMCL 1 0.900 - - OOG6_110734
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4939
SonicParanoid 1 1.000 - - X520
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.