DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp3b

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001037772.1 Gene:dusp3b / 568344 ZFINID:ZDB-GENE-030616-38 Length:177 Species:Danio rerio


Alignment Length:155 Identity:71/155 - (45%)
Similarity:89/155 - (57%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            ||||||.:|:.:||.|.|.|..:|:||:||||||.....|:|...||.|...|          |.
Zfish    31 EVYPGILLGNESAATNVTRLLELGVTHILNAAEGQSDMHVNTDAEYYADTGII----------YH 85

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            |.|..|....|:|.||..||.||..|:...||:.|||..|.||||..|:|:||:...|....|:.
Zfish    86 GIPAFDTDHFDLSIYFEEASDFIQRALEMKGKVYVHCQKGYSRSAALVIAHLMLQHNMDVRAAVA 150

  Fly   203 TVRMRRDIRPNDGFLQQLADLDMEL 227
            |||.:|:|.||||||:||..|:..|
Zfish   151 TVREKREIGPNDGFLRQLCQLNDRL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 70/153 (46%)
dusp3bNP_001037772.1 DSPc 31..172 CDD:238073 69/150 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.