DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and AgaP_AGAP004353

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_001688457.1 Gene:AgaP_AGAP004353 / 5667413 VectorBaseID:AGAP004353 Length:374 Species:Anopheles gambiae


Alignment Length:187 Identity:54/187 - (28%)
Similarity:88/187 - (47%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SMAPSRALPGLR--RAECAIHDVD---CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCR 108
            |:|.|..:|..|  .:....:|::   ...|:|.:.:|:...|.:.:   .:|...|||..  |:
Mosquito    37 SIASSTRVPLARSCSSPAVAYDIESHPASHVFPHLLLGNGRDAIDPS---TVGANCVLNVT--CQ 96

  Fly   109 Y--GQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKIL 171
            .  ||:..|                  .:|...|..|.|..:|.:||..|..||:.|...|..:|
Mosquito    97 QPSGQLKPG------------------LKYKQIPASDTPHQNIKQYFQEAFDFIEEARKKGSTVL 143

  Fly   172 VHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            :||..|:|||||..:||:|..:.:|.::|.:.|::.|. |.||..|:.||.:|:..|
Mosquito   144 LHCQAGISRSATIAIAYVMRYKGLSLIEAYQLVKLARPIISPNLNFMGQLLELEQNL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/158 (30%)
AgaP_AGAP004353XP_001688457.1 DSPc 63..197 CDD:238073 46/156 (29%)
CDC14 <123..208 CDD:225297 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.