DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and si:ch211-121a2.2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001098581.1 Gene:si:ch211-121a2.2 / 564515 ZFINID:ZDB-GENE-070705-21 Length:449 Species:Danio rerio


Alignment Length:222 Identity:81/222 - (36%)
Similarity:107/222 - (48%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PHYYQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAAA 86
            |...:|..|:|          :.|:|......:         |.:......||:|.:.|||...|
Zfish   254 PEPQESKQRIE----------ETVIHLKHCLQK---------CTLDQTSATEVWPSVVIGDEHTA 299

  Fly    87 KNKTYLRLMGITHVLNAAEGCRYG---------------QVDTGHSYYRDMPSIRRSHKDCVFRY 136
            .::..|:..||||:|||| ..::.               :|.||..||:.|.          ..|
Zfish   300 MDRAKLKQRGITHILNAA-AIKHNLMASLGMPRKEDLLRKVKTGAQYYKGMN----------ITY 353

  Fly   137 MGFPMVDAPTTDISRYFYVASKFIDSAISS-GGKILVHCLVGMSRSATCVLAYLMICRKMSAVDA 200
            .|.|:||.|..|||:|||.::.||..|:|. ..|:||||..|:|||.|..||||||.||||..||
Zfish   354 YGVPVVDDPLFDISKYFYPSAAFIHQALSEPENKVLVHCSDGVSRSPTLFLAYLMIHRKMSVEDA 418

  Fly   201 IRTVRMRRDIRPNDGFLQQLADLDMEL 227
            |..|...|.|.||.|||:|||.|:.:|
Zfish   419 IGHVLKVRCIWPNLGFLKQLAVLNSKL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 73/171 (43%)
si:ch211-121a2.2NP_001098581.1 CDC14 61..244 CDD:225297
DSPc 80..223 CDD:238073
DSPc 284..438 CDD:238073 69/164 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.