DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and styx

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001019561.1 Gene:styx / 554088 ZFINID:ZDB-GENE-050522-45 Length:224 Species:Danio rerio


Alignment Length:158 Identity:57/158 - (36%)
Similarity:86/158 - (54%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DCDEVYPGIYIGD-AAAAKNK-TYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDC 132
            :..|:.||:::|. :||.|:| :.|...||||::...:       |...::.:  |:.  .||  
Zfish    29 EMQEILPGLFLGPYSAAMKSKLSMLEKQGITHIVCVRQ-------DIEANFIK--PNF--PHK-- 80

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSA 197
             |||:...:.|.|..:|.|||....:|||..:.:|||:|||...|:||||..|:||||....:..
Zfish    81 -FRYLVLDIADNPVENIIRYFPTTKEFIDGCLETGGKVLVHGNAGISRSAALVIAYLMETFGVKY 144

  Fly   198 VDAIRTVRMRR-DIRPNDGFLQQLADLD 224
            .||...|:.|| .|.||.||:.||.:.:
Zfish   145 RDAFSHVQERRFCINPNVGFVHQLQEYE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 57/157 (36%)
styxNP_001019561.1 DSPc 29..172 CDD:238073 57/156 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.