DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp19

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001016317.1 Gene:dusp19 / 549071 XenbaseID:XB-GENE-941384 Length:215 Species:Xenopus tropicalis


Alignment Length:154 Identity:44/154 - (28%)
Similarity:70/154 - (45%) Gaps:20/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDC 132
            |:....|.|.:.:|....|::...|:...:||:||.|.|     ||..      .|:        
 Frog    63 DLQVGAVKPWLLLGSQDVAQDLDVLKKYKVTHILNVAYG-----VDNA------FPN-------- 108

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSA 197
            .|.|....::|.|.|||:.:|.....|:::.....|.:||||..|:||:....:.:||...|::.
 Frog   109 EFTYKKMSILDLPETDIASFFPECFNFLENVKLQNGVVLVHCNAGVSRAPAIAIGFLMYDEKINF 173

  Fly   198 VDAIRTVRMRRDIR-PNDGFLQQL 220
            ..|...|:..|... ||.||::||
 Frog   174 ARAFSIVKNARPAACPNPGFMEQL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 43/151 (28%)
dusp19NP_001016317.1 DSP_DUSP19 65..201 CDD:350373 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.