DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp4

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001016109.1 Gene:dusp4 / 548863 XenbaseID:XB-GENE-1007215 Length:388 Species:Xenopus tropicalis


Alignment Length:183 Identity:56/183 - (30%)
Similarity:89/183 - (48%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SMAPSRALPGLRRAECA--IHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYG 110
            |:.|:    |:..:.|.  :||.... |:.|.:|:|.|..|..:..|..:.||.::|.:..|   
 Frog   172 SIEPA----GIGCSSCTTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALRITALMNVSADC--- 229

  Fly   111 QVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCL 175
                        |:....|    ::|...|:.|....|||.:|..|.::|||.....|::||||.
 Frog   230 ------------PNHFEGH----YQYKCIPVEDNHKADISSWFMEAIEYIDSVKDQNGRVLVHCQ 278

  Fly   176 VGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            .|:|||||..|||||:.:::...:|...|:.||. |.||..|:.||...:.::
 Frog   279 AGISRSATICLAYLMMTKRVKLEEAFEFVKQRRSIISPNFSFMGQLLQFESQV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 50/157 (32%)
dusp4NP_001016109.1 DSP_MapKP 9..158 CDD:238723
DSP_DUSP4 193..333 CDD:350488 50/158 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.