DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp5

DIOPT Version :10

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001015856.1 Gene:dusp5 / 548573 XenbaseID:XB-GENE-957572 Length:375 Species:Xenopus tropicalis


Alignment Length:224 Identity:42/224 - (18%)
Similarity:77/224 - (34%) Gaps:67/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ANEYGFTVINDFSQSQKKAQRILNDGLQCSLCPNKNCIMKQVVLTSEK----YIIAI-------- 90
            ||:....|:..||......::.|.:.|...|.|.:...|.:.::.:::    |::..        
 Frog   339 ANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGK 403

  Fly    91 --------------GLSLI----SDFDAG-------------------------LALSFADSY-K 111
                          |.|::    ..|.||                         :...|...| |
 Frog   404 STNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGK 468

  Fly   112 NKLTVCTQHIADALNQIFDFLHLKSTEDLYIMINSDDA--MSNLMKVVVDRCPDLPELIGFDEVS 174
            :...:..:.||.|.||.||.:.:.:...:     .|:|  |:.|.|::....|||...:|...|.
 Frog   469 DAAGIAMEAIAFARNQGFDVVLVDTAGRM-----QDNAPLMTALAKLITVNTPDLVLFVGEALVG 528

  Fly   175 ANFIDEMCKF----VKRNQCRVRNLMDPI 199
            ...:|::.||    ...:..:...|:|.|
 Frog   529 NEAVDQLVKFNRALADHSMAQTPRLIDGI 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 33/191 (17%)
dusp5NP_001015856.1 DSP_MapKP 6..135 CDD:238723
DSP_DUSP5 171..309 CDD:350487
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.