DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and STYXL1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_016867785.1 Gene:STYXL1 / 51657 HGNCID:18165 Length:351 Species:Homo sapiens


Alignment Length:204 Identity:44/204 - (21%)
Similarity:80/204 - (39%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GRQLQRVLHYSMAPSRALPG-----------LRRAECAIHDVDCD-------EVYPG-IYIGDAA 84
            ||.|.|:.|:   |...|.|           ||..:......:.|       |:.|| :::|:.:
Human   151 GRILTRLTHH---PVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFS 212

  Fly    85 AAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDI 149
            .|.:....:.:.|...:|.:       :|||..:..|...:           :...:.|:|...|
Human   213 QACDPKIQKDLKIKAHVNVS-------MDTGPFFAGDADKL-----------LHIRIEDSPEAQI 259

  Fly   150 SRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTV-RMRRDIRPN 213
            ..:......||:.....|..||:....|:|||...::||||...:.:...:...| :.:.::.||
Human   260 LPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPN 324

  Fly   214 DGFLQQLAD 222
            .|.:.||.:
Human   325 RGLVSQLLE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 34/161 (21%)
STYXL1XP_016867785.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.