DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP13

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_005269940.1 Gene:DUSP13 / 51207 HGNCID:19681 Length:417 Species:Homo sapiens


Alignment Length:211 Identity:89/211 - (42%)
Similarity:122/211 - (57%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPHYYQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAA 85
            ||  ||.|         |...|||:|           .:|:|....|   .|||:|.:::|||.|
Human   240 SP--YQPP---------TLASLQRLL-----------WVRQAATLNH---IDEVWPSLFLGDAYA 279

  Fly    86 AKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDIS 150
            |::|:.|..:|||||:|||.| :: |||||..:||.|.          ..|.|....|.|..|:|
Human   280 ARDKSKLIQLGITHVVNAAAG-KF-QVDTGAKFYRGMS----------LEYYGIEADDNPFFDLS 332

  Fly   151 RYFYVASKFIDSAIS-SGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPND 214
            .||...:::|.:|:| ..|::||||.:|:|||||.|||:||||..|:.|:||:||:..|:|.||.
Human   333 VYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNS 397

  Fly   215 GFLQQLADLDMELKRK 230
            |||:||..||..|.|:
Human   398 GFLRQLQVLDNRLGRE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 74/156 (47%)
DUSP13XP_005269940.1 DSPc 264..407 CDD:238073 73/157 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5579
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4582
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm41148
orthoMCL 1 0.900 - - OOG6_110734
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4939
SonicParanoid 1 1.000 - - X520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.