DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_006247464.1 Gene:Dusp3 / 498003 RGDID:1560049 Length:212 Species:Rattus norvegicus


Alignment Length:201 Identity:78/201 - (38%)
Similarity:111/201 - (55%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSRALPGLRRAECAIHDVD----------------CDEVYPGIYIGDAAAAKNKTYLRLMGITHV 100
            |:.|:.|  ..|.::.|::                |:||.|.:|:|:|:.|::.|.|:.:|||||
  Rat    23 PAAAMSG--SFELSVQDLNDLLSDGSGCYSLPSQPCNEVIPRVYVGNASVAQDITQLQKLGITHV 85

  Fly   101 LNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAIS 165
            ||||||..:..|:|..|:|          ||....|||....|....::|.||..|:.|||.|::
  Rat    86 LNAAEGRSFMHVNTSASFY----------KDTGITYMGIKANDTQEFNLSAYFERAADFIDQALA 140

  Fly   166 -SGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMELKR 229
             ..|::||||..|.|||.|.|:||||:.:||....|:.|||..|:|.||||||.||..|:..|..
  Rat   141 HKNGRVLVHCREGYSRSPTLVIAYLMLRQKMDVRSALSTVRQNREIGPNDGFLAQLCQLNDRLAE 205

  Fly   230 KNLYPY 235
            :...|:
  Rat   206 EGKDPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 71/156 (46%)
Dusp3XP_006247464.1 DSPc 55..200 CDD:238073 70/154 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5662
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.