DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001005450.2 Gene:dusp1 / 448043 XenbaseID:XB-GENE-975056 Length:369 Species:Xenopus tropicalis


Alignment Length:237 Identity:71/237 - (29%)
Similarity:104/237 - (43%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALLTDRYSSSIGDRYSPHYYQSPSRLETSEQTTGRQLQRVLHYSMAP--------SRALPGLRRA 62
            ||..|...|||       |:     |:...:|...|.....:.|..|        :..:||...:
 Frog   109 ALCRDSRGSSI-------YF-----LKGGYETFSSQCPEFCNKSSPPVCLSLPLSTSNVPGSADS 161

  Fly    63 ECA-----IHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRD 121
            .|.     ::|.... |:.|.:|:|.|..|..|..|..:|||.::|.:..|              
 Frog   162 NCTPCGTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANC-------------- 212

  Fly   122 MPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVL 186
             |:....|    |:|...|:.|:...|||.:|..|..||||..:|||::.|||..|:|||||..|
 Frog   213 -PNHFEGH----FQYKSIPVEDSHKADISSWFNEAIDFIDSVKNSGGRVFVHCQAGISRSATICL 272

  Fly   187 AYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            ||||...::...:|...|:.||. |.||..|:.||...:.::
 Frog   273 AYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 55/157 (35%)
dusp1NP_001005450.2 DSP_MapKP 9..137 CDD:238723 10/39 (26%)
DSP_DUSP1 176..326 CDD:350486 55/158 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.