DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and styxl1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001004619.1 Gene:styxl1 / 447880 ZFINID:ZDB-GENE-040912-45 Length:295 Species:Danio rerio


Alignment Length:240 Identity:57/240 - (23%)
Similarity:105/240 - (43%) Gaps:32/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SWRYALLTDRYSSSIGDRYSPHYYQSPSRLETSEQ------TTGRQLQRVLHYSMAPSRALPGLR 60
            |.||.::.|..:.|:.|  |.........||.:.|      |.|.:....|:..:...:.|..:|
Zfish    71 SMRYIIVYDSGTQSLSD--SGPAIDCADSLEKASQFPIQILTGGYEKFSALYPFLRTEKILYNIR 133

  Fly    61 RAECA-IHDVDCDEVYPG-IYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMP 123
            ..|.. ::.|   |:.|| :|:||...|.|...|:.:.:..::|.:..|                
Zfish   134 ELESLNLYPV---EILPGQLYMGDYRQATNLKVLKDLKLNAIVNVSNDC---------------- 179

  Fly   124 SIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAY 188
            |:.....:|...::  .:.|:...|:...|.....||:|.:::...:||...:|.||.....:||
Zfish   180 SLIFKKANCTVLHI--RVADSAEADLVTSFERICVFINSHLNNASSVLVFSTLGKSRCCAVAMAY 242

  Fly   189 LMICRKMSAVDAIRTVRM-RRDIRPNDGFLQQLADLDMELKRKNL 232
            ||...|.:..:|...::. :.::|||.||:|||:|.:::...|.:
Zfish   243 LMSHLKYTIKEAWNHIQQCKANMRPNRGFVQQLSDWELQTLGKRV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 39/157 (25%)
styxl1NP_001004619.1 RHOD 33..121 CDD:294087 13/51 (25%)
PTPc 142..279 CDD:304379 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.