DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Mkp

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster


Alignment Length:165 Identity:56/165 - (33%)
Similarity:80/165 - (48%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CAIHDVDCDEVYPGIYIG--DAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIR 126
            |.:.|.        :|:|  ||.:|.|....:   |||:|:.  |.:..:|:.      .:|   
  Fly    68 CILSDF--------LYLGSQDAVSADNIIKYK---ITHILSV--GIQTPEVEW------PLP--- 110

  Fly   127 RSHKDCVFRYMGFPMVDAPTTDISRYFYVAS-KFIDSAISSGGKILVHCLVGMSRSATCVLAYLM 190
               .:|.|    .|.:|.|.|::..|...|| :||:.|..|.|.:||||..|:|||.:.|:.|||
  Fly   111 ---VNCTF----LPCLDLPETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLM 168

  Fly   191 ICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLD 224
            ..|.|...||...|:..|. |:||.||:|||...|
  Fly   169 QRRDMCYEDAYNLVKSWRPCIQPNAGFIQQLKRSD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 54/158 (34%)
MkpNP_001036572.1 DSPc 66..200 CDD:238073 54/160 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.