DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp23b

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001002462.1 Gene:dusp23b / 436735 ZFINID:ZDB-GENE-040718-163 Length:152 Species:Danio rerio


Alignment Length:141 Identity:40/141 - (28%)
Similarity:59/141 - (41%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VYPGIYIGDAAAAKNKTYLRLM--GITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDC---V 133
            |.||...|.|.......|..|:  ||.|::...|              |..|    .|..|   .
Zfish    12 VDPGKVAGLAMPRMTAHYQYLLNSGIKHLVTLTE--------------RKPP----DHDTCPDLT 58

  Fly   134 FRYMGFPMVDAPTTD-ISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSA 197
            ..::......|||.: |:|:..:    ::.|.:||..:.||||.|..|:.|.:..||:..||:|.
Zfish    59 LHHIKINDFCAPTFEQINRFLTI----VEEANASGQAVAVHCLHGFGRTGTMLACYLVKSRKISG 119

  Fly   198 VDAIRTVRMRR 208
            :|||..:|..|
Zfish   120 IDAINEIRRIR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 40/141 (28%)
dusp23bNP_001002462.1 PTPc 34..134 CDD:304379 33/119 (28%)
CDC14 <61..146 CDD:225297 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.