DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and CG15528

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:173 Identity:53/173 - (30%)
Similarity:82/173 - (47%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRD 121
            |||.|            :.|.:.:..|||.. ..|:..:|::.|:|.|...    .||      .
  Fly    42 PGLSR------------ITPSLILCGAAAVV-PAYMDKLGVSCVINVAPEL----PDT------P 83

  Fly   122 MPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVL 186
            :||.:..      .|:.....|....|::::|..|:..|:....|||..|:||:.|:||||:..|
  Fly    84 LPSQKNP------LYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLIHCVAGVSRSASLCL 142

  Fly   187 AYLMICRKMSAVDAIRTVR-MRRDIRPNDGFLQQLADLDMELK 228
            ||||....||..:|.:.|: :|..:|||.||.|||...:.:|:
  Fly   143 AYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 48/156 (31%)
CG15528NP_651767.2 DSPc 43..181 CDD:238073 51/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.