DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and ssh

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster


Alignment Length:201 Identity:51/201 - (25%)
Similarity:89/201 - (44%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCD------------EVYPGIYIGDAAA 85
            ||:...|| |:.:|...:...::.            :|.:            :::..:|:|....
  Fly   348 TSKYIRGR-LEEILDMDLGEYKSF------------IDAEMLVILGQMDAPTKIFEHVYLGSEWN 399

  Fly    86 AKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDIS 150
            |.|...|:..|:.|:||...     ::|   :::   |.        .|.|....:.|...|::.
  Fly   400 ASNLEELQKNGVRHILNVTR-----EID---NFF---PG--------TFEYFNVRVYDDEKTNLL 445

  Fly   151 RYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPND 214
            :|:....::|..|.:.|.|:||||.:|:||||:.|:||.|...:.....|:..|:.||. |:||.
  Fly   446 KYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNK 510

  Fly   215 GFLQQL 220
            .||.||
  Fly   511 NFLNQL 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 44/163 (27%)
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 7/43 (16%)
DSPc 385..519 CDD:238073 44/151 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.