DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_998232.1 Gene:dusp1 / 406340 ZFINID:ZDB-GENE-040426-2018 Length:360 Species:Danio rerio


Alignment Length:156 Identity:52/156 - (33%)
Similarity:79/156 - (50%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            |:.|.:|:|.|..|..|..|.::|||.::|.:..|               |:....|    ::|.
Zfish   178 EILPFLYLGSAYHASRKDMLDMLGITALINVSSNC---------------PNHFEDH----YQYK 223

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            ..|:.|....:||.:|..|.:||||..:.||::.|||..|:|||||..|||||...::...:|..
Zfish   224 SIPVEDNHKANISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLEEAFE 288

  Fly   203 TVRMRRD-IRPNDGFLQQLADLDMEL 227
            .|:.||. |.||..|:.||...:.::
Zfish   289 FVKQRRSIISPNFSFMGQLLQFESQV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 52/154 (34%)
dusp1NP_998232.1 DSP_MapKP 8..137 CDD:238723
DSPc 175..311 CDD:238073 52/151 (34%)
CDC14 <225..326 CDD:225297 36/90 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.