DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and CG10089

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:153 Identity:48/153 - (31%)
Similarity:76/153 - (49%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            :|.||:|:|:...:|:...|....|:|::...:..|           |.:|.   .|..||.   
  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPR-----------RLLPD---KHYLCVM--- 54

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
               ..|.|..::|:||.|.:.||.:|....|.:|:|||.|||||.|..:||:|....::..:|::
  Fly    55 ---ASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALK 116

  Fly   203 TVRMRRDI-RPNDGFLQQLADLD 224
            .||..|.: .||.||..||.:.:
  Fly   117 VVRAGRAVANPNAGFQSQLQEFE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 48/153 (31%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.