DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp4

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_957465.1 Gene:dusp4 / 394146 ZFINID:ZDB-GENE-040426-709 Length:367 Species:Danio rerio


Alignment Length:233 Identity:70/233 - (30%)
Similarity:102/233 - (43%) Gaps:45/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALLTDRYSSSI------GDRYS---PHYYQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRR 61
            ||..|.:|:.:      .||:|   |.|......|..|...:..:       |...|.|.|.   
Zfish   111 ALCRDTFSTEVYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSME-------SSCLSCATPQ--- 165

  Fly    62 AECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSI 125
                 ||.... |:.|.:::|.|..|..|..|..|||:.:||.:..|                  
Zfish   166 -----HDQGGPVEILPFLFLGSALHASKKDMLDRMGISALLNVSSNC------------------ 207

  Fly   126 RRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLM 190
             .:|.:..::|...|:.|....|||.:|..|.:||||...|.|::||||..|:|||||..|||||
Zfish   208 -PNHFEGDYQYKCIPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLM 271

  Fly   191 ICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            ..:::...:|...|:.||. |.||..|:.||...:.::
Zfish   272 KKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 53/157 (34%)
dusp4NP_957465.1 DSP_MapKP 9..139 CDD:238723 8/27 (30%)
DSPc 170..306 CDD:238073 53/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.