DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Ssh3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_038941418.1 Gene:Ssh3 / 365396 RGDID:1308679 Length:697 Species:Rattus norvegicus


Alignment Length:230 Identity:58/230 - (25%)
Similarity:92/230 - (40%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRA-----ECAIHD----VD------------CD 72
            |..|..||....:|.:||..|...|.....:|:|     .|.:..    :|            ..
  Rat   292 SEQEQMEQAILAELWQVLDASDLDSVTSKEIRQALELRLGCPLQQYRDFIDNQMLLLMAQQDRAS 356

  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            .::|.:|:|....|.|...|:...::|:||.|.     ::|   :::.:.           |.|.
  Rat   357 RIFPHLYLGSEWNAANLEELQRNRVSHILNMAR-----EID---NFFPER-----------FTYH 402

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSA-----------IS-----SGGKILVHCLVGMSRSATCVL 186
            ...:.|..:..:..::....:||:.|           ||     .|.::||||.:|:||||..||
  Rat   403 NVRVWDEESAQLLPHWKETHRFIEDARLLGLKGNGLTISHLHRAQGTRVLVHCKMGVSRSAATVL 467

  Fly   187 AYLMICRKMSAVDA-IRTVRMRRDIRPNDGFLQQL 220
            ||.|.........| |....:|..:|||.|||:||
  Rat   468 AYAMKQYGWGLEQALIHVQELRPIVRPNPGFLRQL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 45/167 (27%)
Ssh3XP_038941418.1 SSH-N 32..279 CDD:212166
DEK_C 298..349 CDD:400903 11/50 (22%)
DSP_slingshot_3 352..511 CDD:350419 45/170 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.