DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp15

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001102068.2 Gene:Dusp15 / 362238 RGDID:1305990 Length:244 Species:Rattus norvegicus


Alignment Length:173 Identity:49/173 - (28%)
Similarity:75/173 - (43%) Gaps:37/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCV--FR 135
            :|.||:|:|:...||:...|....|||::                      ||..|.:..:  ..
  Rat     7 KVLPGLYLGNFIDAKDPDQLGRNKITHIV----------------------SIHESPQPLLQDIT 49

  Fly   136 YMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCL--------VGMSRSATCVLAYLMIC 192
            |:...:.|.|...|.::|.....||.|...:||..|||||        .|:|||.|.|:||:|..
  Rat    50 YLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCLSFTSGSFFAGISRSTTVVIAYVMTV 114

  Fly   193 RKMSAVDAIRTVRMRRDI-RPNDGFLQQLADL----DMELKRK 230
            ..:...:.:..::..|.| .||.||.|||.:.    ..:|:|:
  Rat   115 TGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/168 (28%)
Dusp15NP_001102068.2 DSPc 4..146 CDD:238073 47/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.