DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp13

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_008768696.2 Gene:Dusp13 / 361002 RGDID:1359712 Length:391 Species:Rattus norvegicus


Alignment Length:211 Identity:86/211 - (40%)
Similarity:119/211 - (56%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPHYYQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAA 85
            ||  ||.|         |...|||:|           .:||.....|   .:||:|.:::|||.|
  Rat   214 SP--YQPP---------TLASLQRLL-----------WVRRTSTLTH---INEVWPNLFLGDAYA 253

  Fly    86 AKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDIS 150
            |::|:.|..:|||||:|.|.| :: |||||..:||..|          ..|.|....|.|..|:|
  Rat   254 ARDKSRLIQLGITHVVNVAAG-KF-QVDTGAKFYRGTP----------VEYYGIEADDNPFFDLS 306

  Fly   151 RYFYVASKFIDSAISS-GGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPND 214
            .||...:::|..|::: ..::||||.:|:|||||.|||:|||...|:.||||:||:..|||.||.
  Rat   307 VYFLPVARYIRDALNTPRSRVLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQAHRDICPNS 371

  Fly   215 GFLQQLADLDMELKRK 230
            |||:||..||..|:|:
  Rat   372 GFLRQLQVLDNRLRRE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 71/156 (46%)
Dusp13XP_008768696.2 PTP_DSP_cys 221..384 CDD:421693 78/188 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4500
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm45289
orthoMCL 1 0.900 - - OOG6_110734
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X520
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.