DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Styxl1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001032877.2 Gene:Styxl1 / 360792 RGDID:1305845 Length:321 Species:Rattus norvegicus


Alignment Length:265 Identity:58/265 - (21%)
Similarity:99/265 - (37%) Gaps:69/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYALLTDRYSSSIGDRYSPHYYQSPSRLETSEQTTGRQ-------------LQRVLHYSMAPSRA 55
            :|.::.|..:||:.....|.|.:...  |..|:..|::             .|.::|::..|...
  Rat    72 KYCIVYDSNTSSLELSIRPRYEEEEE--EEEEEKEGKEDDSELLPGPAVEFGQILIHFTRQPVYI 134

  Fly    56 LPG----------LRRAECAI---HDVDC-----DEVYPG-IYIGDAAAAKN-KTYLRLMGITHV 100
            |.|          ..|.:..|   .::|.     .|:.|| :::|..:.|.| |.:..|....||
  Rat   135 LRGGYECFSGLYHFFRTQKVIWMPQELDAFLPYPIEIVPGKVFLGKLSQACNAKMHKDLKIKAHV 199

  Fly   101 LNAAEGCRY--GQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSA 163
            ..:.|...|  |.||                     :.:...:.|.|.:.:...|...|.||:..
  Rat   200 NISLETTPYFVGNVD---------------------KLLHIKIEDTPDSILFPSFRHISHFIELH 243

  Fly   164 ISSGGKILVHCLVGMSRSATCVLAYLM------ICRKMSAVDAIRTVRMRRDIRPNDGFLQQLAD 222
            :.....|||....|:|||...|:|:||      :.|..:.|...:|     ::|||...:.||.:
  Rat   244 LKLRSVILVFSTRGISRSVAAVVAFLMHYNEETLKRSWAHVKKCKT-----NMRPNRALVAQLLE 303

  Fly   223 LDMEL 227
            .:..|
  Rat   304 WEKAL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 40/170 (24%)
Styxl1NP_001032877.2 RHOD 33..146 CDD:412175 14/75 (19%)
PTP_DSP_cys 158..311 CDD:421693 42/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.