DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and AgaP_AGAP009628

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_553421.2 Gene:AgaP_AGAP009628 / 3292014 VectorBaseID:AGAP009628 Length:324 Species:Anopheles gambiae


Alignment Length:124 Identity:25/124 - (20%)
Similarity:47/124 - (37%) Gaps:21/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RSHKDCVFRYMG-FPMVDAPTTDISRYFYVASKF---IDSAIS--SGGKILVHCLVGMSRSATCV 185
            |::...:|.|.. :|..|....||.    :..||   :||.::  |...:.:||..|..|:.|.:
Mosquito    80 RTYDPKLFPYHAEYPFKDHNPPDIE----LIDKFCKDVDSFLNADSSHVVAIHCKAGKGRTGTMI 140

  Fly   186 LAYLMICRKMSAVDAIRTVRMRRDIRPNDG-----------FLQQLADLDMELKRKNLY 233
            ..||:............|....:..:...|           :.:||...::..::.:||
Mosquito   141 CCYLLYNNSFQTAHEALTYYAEKRTKDKKGVTIPSQRRYVVYYEQLLRQNLTYRKVSLY 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 23/116 (20%)
AgaP_AGAP009628XP_553421.2 CDC14 5..187 CDD:225297 22/110 (20%)
PTPc_motif 96..187 CDD:214649 18/94 (19%)
PTEN_C2 <243..316 CDD:287393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.