DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and ssh2a

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_005157728.1 Gene:ssh2a / 325085 ZFINID:ZDB-GENE-030131-3810 Length:1175 Species:Danio rerio


Alignment Length:154 Identity:46/154 - (29%)
Similarity:75/154 - (48%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            |::..:|:|....|.|...|:..|:.::||...     ::|   :::   |.:        |.|.
Zfish   319 EIFDHVYLGSEWNASNLEELQNSGVRYILNVTR-----EID---NFF---PGL--------FEYH 364

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            ...:.|...|::..|:....|||..|..:|.|.||||.:|:||||:.|:||.|   |....|..|
Zfish   365 NIRVYDEEATNLLEYWNDTYKFISKAKKAGVKCLVHCKMGVSRSASTVIAYAM---KEYGWDLDR 426

  Fly   203 T---VRMRRDI-RPNDGFLQQLAD 222
            .   |:.||.: :||..|::||.:
Zfish   427 AFDHVKERRSVTKPNPSFMKQLEE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 46/154 (30%)
ssh2aXP_005157728.1 SSH-N 12..245 CDD:212166
DEK_C 260..311 CDD:285919
DSPc 317..452 CDD:238073 46/154 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.