DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001012089.1 Gene:Dusp2 / 311406 RGDID:1305804 Length:318 Species:Rattus norvegicus


Alignment Length:187 Identity:63/187 - (33%)
Similarity:92/187 - (49%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SMAPSRALP--GLRR----AECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEG 106
            |.||::|||  |...    ....|:|.... |:.|.:|:|....:.:...|:..|||.|||.:..
  Rat   148 SEAPAQALPPAGAENNSSDPRVPIYDQGGPVEILPYLYLGSCNHSSDLQGLQACGITAVLNVSAS 212

  Fly   107 CRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKIL 171
            |                   .:|.:.:|||...|:.|....:||.:|..|..||||..:|||::|
  Rat   213 C-------------------PNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDSVKNSGGRVL 258

  Fly   172 VHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            |||..|:|||||..||||:...::...:|...|:.||. |.||..|:.||..|:.::
  Rat   259 VHCQAGISRSATICLAYLIQSHRVRLDEAFDFVKQRRGVISPNFSFMGQLLQLETQV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 54/157 (34%)
Dusp2NP_001012089.1 DSP_MapKP 12..147 CDD:238723
DSPc 176..312 CDD:238073 53/154 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.