DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp19

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001101209.2 Gene:Dusp19 / 311151 RGDID:1307457 Length:220 Species:Rattus norvegicus


Alignment Length:157 Identity:46/157 - (29%)
Similarity:75/157 - (47%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDC 132
            |:....:.|.:.:|...||.:...||...:||:||.|.|               :.::..|.   
  Rat    62 DLQVGVIKPWLLLGSQDAAHDLELLRQHKVTHILNVAYG---------------VENVFLSE--- 108

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSA 197
             |.|....::|.|.|:|..||....:||:.|....|.:||||..|:||:|..|:.:||...:::.
  Rat   109 -FTYKTISILDVPETNILSYFPECFEFIEQAKLKDGVVLVHCNAGVSRAAAVVIGFLMSSEELAF 172

  Fly   198 VDAIRTVRMRRDIRP----NDGFLQQL 220
            .:|:..|   ::.||    |.||::||
  Rat   173 TNALSLV---KEARPSICLNPGFMEQL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 45/154 (29%)
Dusp19NP_001101209.2 DSPc 64..199 CDD:238073 45/155 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.