DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp26

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001012352.1 Gene:Dusp26 / 306527 RGDID:1310090 Length:211 Species:Rattus norvegicus


Alignment Length:238 Identity:87/238 - (36%)
Similarity:123/238 - (51%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SWRYALLTDRYSSSIGDRYSPHYYQSPSRLETSEQTTGR---------QLQRVLHYSMAPSRALP 57
            :|.:|.:|      ...|:|....:||.|...|.:....         :|:|:|:..        
  Rat     5 NWLWASMT------FMARFSRSSSRSPVRTRGSLEEMPSVHHPFLNVFELERLLYTG-------- 55

  Fly    58 GLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDM 122
               :..|.    ..|||:||:|:||...|.|:..||.:||||||||:           ||.:|..
  Rat    56 ---KTACN----HADEVWPGLYLGDQDMANNRRELRRLGITHVLNAS-----------HSRWRGT 102

  Fly   123 PSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISS-GGKILVHCLVGMSRSATCVL 186
            |   .:::....||:|....|:|..|:|.:|..|:.||..|:|. ||||||||.||:|||||.||
  Rat   103 P---EAYEGLGIRYLGVEAHDSPAFDMSVHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVL 164

  Fly   187 AYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMELKR 229
            ||||:....:.|:||:.|:..|.|.||.|||:||..||..|::
  Rat   165 AYLMLYHHFTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 73/156 (47%)
Dusp26NP_001012352.1 DSPc 61..202 CDD:238073 71/154 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11421
Inparanoid 1 1.050 133 1.000 Inparanoid score I4500
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm45289
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.