DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp18

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001013146.2 Gene:Dusp18 / 305477 RGDID:1306929 Length:204 Species:Rattus norvegicus


Alignment Length:181 Identity:57/181 - (31%)
Similarity:86/181 - (47%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSRALPGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGH 116
            |..::.||            .::...::|.:.|||.:|..|....||.|:|.:       |:..:
  Rat    13 PQPSISGL------------SQITKSLFISNGAAANDKLLLSSNQITTVINVS-------VEVAN 58

  Fly   117 SYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRS 181
            ::|.|:            :|:..|:||||...:|.:|...:..|.|.....|:.|:||..|:|||
  Rat    59 TFYEDI------------QYVQVPVVDAPIARLSDFFDPIADHIHSVEMKQGRTLLHCAAGVSRS 111

  Fly   182 ATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMELKRKN 231
            |...|||||....||.:||....:.||. ||||.||.:||...:.:|..||
  Rat   112 AALCLAYLMKYHAMSLLDAHAWTKSRRPIIRPNSGFWEQLIHYEFQLFGKN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/156 (33%)
Dusp18NP_001013146.2 DUSP18_21 19..176 CDD:350421 56/175 (32%)
Sufficient for mitochondrial localization. /evidence=ECO:0000250 95..141 20/45 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.