DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Ssh2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_038941949.1 Gene:Ssh2 / 303342 RGDID:1309389 Length:1450 Species:Rattus norvegicus


Alignment Length:151 Identity:44/151 - (29%)
Similarity:73/151 - (48%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            :::..:::|....|.|...|:..|:.::||...     ::|   :::   |.        ||.|.
  Rat   337 QIFEHVFLGSEWNASNLEDLQNRGVRYILNVTR-----EID---NFF---PG--------VFEYH 382

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            ...:.|...||:..|:....|||..|...|.|.||||.:|:||||:.|:||.|.....:...|..
  Rat   383 NIRVYDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYE 447

  Fly   203 TVRMRRDI-RPNDGFLQQLAD 222
            .|:.||.: :||..|::||.:
  Rat   448 YVKERRTVTKPNPSFMRQLEE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 44/151 (29%)
Ssh2XP_038941949.1 SSH-N 38..263 CDD:212166
DEK_C 277..329 CDD:400903
DSP_slingshot_2 332..475 CDD:350417 44/151 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.