DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp16

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001100094.1 Gene:Dusp16 / 297682 RGDID:1310721 Length:661 Species:Rattus norvegicus


Alignment Length:186 Identity:55/186 - (29%)
Similarity:83/186 - (44%) Gaps:33/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SRALPGLRRAECA------------IHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAE 105
            ||..|||...:..            :.:.....:.|.:|:|......||..::..||.:||||:.
  Rat   129 SRCFPGLCEGKSTLVPTCISQPCLPVANTGPTRILPNLYLGCQRDVLNKELMQQNGIGYVLNASN 193

  Fly   106 GCRYGQVDTGHSYYRDMPS-IRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGK 169
            .|             ..|. |..||      ::..|:.|:....|..:...:..||:.|.:|.|.
  Rat   194 TC-------------PKPDFIPESH------FLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGC 239

  Fly   170 ILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR-DIRPNDGFLQQLADLD 224
            :|:|||.|:|||||..:||:|....||..:|.|.|:.:| .|.||..|:.||.|.:
  Rat   240 VLIHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFMGQLMDYE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 50/156 (32%)
Dusp16NP_001100094.1 DSP_MapKP 10..136 CDD:238723 4/6 (67%)
PTP_DSP_cys 158..301 CDD:421693 50/157 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.