DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and pmp1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_595205.1 Gene:pmp1 / 2540019 PomBaseID:SPBC1685.01 Length:278 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:48/221 - (21%)
Similarity:83/221 - (37%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPG----IYIGDAAAAKNKTY 91
            ||..|:.:..||       ..|....|...:|.    ..:.::.||.    ||..:.......|.
pombe    24 LENEEEASHSQL-------FTPCPVPPSFPKAS----KPNSNQPYPNGPVCIYPPNIYLYAKPTM 77

  Fly    92 LRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYV- 155
            ..:.....|:|.|:...: ...|...:|||     ..|.           :|....|...|.:: 
pombe    78 PIIQSFDVVINVAKEVLH-PFRTDGRHYRD-----SKHN-----------LDIQVFDHIEYVHIH 125

  Fly   156 ----------ASKFID----SAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRM 206
                      ..|.:.    :|:....|:|::|.:|:||||..::|::|....::..||...|:.
pombe   126 WDHDTQFALELDKLVSFVAYNAMQLNKKVLINCQMGISRSACLMIAFIMKTLNLNVSDAYEYVKE 190

  Fly   207 RRD-IRPNDGFLQQLADLDMELKRKN 231
            |.. |.||...:.||::. .::.|||
pombe   191 RSPWIGPNMSLIFQLSEY-QQIIRKN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 37/175 (21%)
pmp1NP_595205.1 CDC14 35..227 CDD:225297 44/210 (21%)
DSPc 61..209 CDD:238073 35/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.