DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Ssh3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001361616.1 Gene:Ssh3 / 245857 MGIID:2683546 Length:653 Species:Mus musculus


Alignment Length:217 Identity:57/217 - (26%)
Similarity:92/217 - (42%) Gaps:47/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRA-----ECAIHD----VD------------CD 72
            |..|..||....:|.:||..|...|.....:|:|     .|.:..    :|            ..
Mouse   267 SEQEKMEQAILAELWQVLDTSDLDSVTSKEIRQALELRLGCPLQQYRDFIDNQMLLLMAQQDRAS 331

  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            .::|.:|:|....|.|...|:...::|:||.|.     ::|   :::.:.           |.|.
Mouse   332 RIFPHLYLGSEWNAANLEELQKNRVSHILNMAR-----EID---NFFPER-----------FTYY 377

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVD--- 199
            ...:.|..:..:..::....:||:.|.:.|.::||||.:|:||||..||||.|   |....|   
Mouse   378 NVRVWDEESAQLLPHWKETHRFIEDARAQGTRVLVHCKMGVSRSAATVLAYAM---KQYGWDLEQ 439

  Fly   200 -AIRTVRMRRDIRPNDGFLQQL 220
             .|....:|..:|||.|||:||
Mouse   440 ALIHVQELRPIVRPNHGFLRQL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 44/154 (29%)
Ssh3NP_001361616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
SSH-N 3..256 CDD:212166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..90
DEK_C 273..324 CDD:370106 11/50 (22%)
DSP_slingshot_3 327..470 CDD:350419 44/157 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 612..653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.