DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp27

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001028516.2 Gene:Dusp27 / 240892 MGIID:2685055 Length:1138 Species:Mus musculus


Alignment Length:214 Identity:78/214 - (36%)
Similarity:123/214 - (57%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QSPSRLETSEQTT-----GRQLQRVLHYSMAPSRALPGLRRA------ECAIHDVDCDEVYPGIY 79
            :.|..||::||..     .|..:::...|:..:..:..|:||      |...::|  |||:|.::
Mouse    80 ECPGMLESAEQLLVEDLYNRVREKMDDRSLFNTPCVLDLQRALTQDRQEAPRNEV--DEVWPNVF 142

  Fly    80 IGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDA 144
            |.:.:.|.||..|:.:||||:||||.|.   .|.||..:|..:.          .:|:|..:.|.
Mouse   143 IAEKSVAVNKGRLKRLGITHILNAAHGT---GVYTGSEFYTGLE----------IQYLGVEVDDF 194

  Fly   145 PTTDISRYFYVASKFIDSA-ISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR 208
            |..|||::|..|::|:|.| ::..||:||...:|:||||..|:|||||...|:.::|:.|||.:|
Mouse   195 PEVDISQHFRKAAEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYLMIFHSMAILEALMTVRRKR 259

  Fly   209 DIRPNDGFLQQLADLDMEL 227
            .|.||||||:||.:|:.:|
Mouse   260 AIYPNDGFLKQLRELNEKL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 65/156 (42%)
Dusp27NP_001028516.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
DSPc 133..275 CDD:238073 65/156 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..336
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..473
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 552..575
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 592..618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..694
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 761..800
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 850..1117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43217
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.