DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Ssh1

DIOPT Version :10

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_011246495.1 Gene:Ssh1 / 231637 MGIID:2686240 Length:1073 Species:Mus musculus


Alignment Length:163 Identity:49/163 - (30%)
Similarity:80/163 - (49%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMG 138
            ::..:|:|....|.|...|:..|:.::||...     ::|   :::   |.:        |.|..
Mouse   343 IFDHLYLGSEWNASNLEELQGSGVDYILNVTR-----EID---NFF---PGL--------FAYHN 388

  Fly   139 FPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRT 203
            ..:.|..|||:..::..|..||:.|..:..|.||||.:|:||||:.|:||.|.........|...
Mouse   389 IRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNY 453

  Fly   204 VRMRRDI-RPNDGFLQQLAD----LDMELKRKN 231
            |:.:|.| |||.||::||::    ||...:|.|
Mouse   454 VKQKRSITRPNAGFMRQLSEYEGILDASKQRHN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/157 (30%)
Ssh1XP_011246495.1 SSH-N 65..268 CDD:212166
DEK_C 282..334 CDD:462592
DSP_slingshot_1 337..480 CDD:350418 46/155 (30%)
PTZ00449 <689..1068 CDD:185628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.