DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Ssh1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_011246495.1 Gene:Ssh1 / 231637 MGIID:2686240 Length:1073 Species:Mus musculus


Alignment Length:163 Identity:49/163 - (30%)
Similarity:80/163 - (49%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMG 138
            ::..:|:|....|.|...|:..|:.::||...     ::|   :::   |.:        |.|..
Mouse   343 IFDHLYLGSEWNASNLEELQGSGVDYILNVTR-----EID---NFF---PGL--------FAYHN 388

  Fly   139 FPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRT 203
            ..:.|..|||:..::..|..||:.|..:..|.||||.:|:||||:.|:||.|.........|...
Mouse   389 IRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNY 453

  Fly   204 VRMRRDI-RPNDGFLQQLAD----LDMELKRKN 231
            |:.:|.| |||.||::||::    ||...:|.|
Mouse   454 VKQKRSITRPNAGFMRQLSEYEGILDASKQRHN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/157 (30%)
Ssh1XP_011246495.1 SSH-N 65..268 CDD:212166
DEK_C 282..334 CDD:370106
DSP_slingshot_1 337..480 CDD:350418 46/155 (30%)
PTZ00449 <689..1068 CDD:185628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.