DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_038670.1 Gene:Dusp1 / 19252 MGIID:105120 Length:367 Species:Mus musculus


Alignment Length:196 Identity:62/196 - (31%)
Similarity:91/196 - (46%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGI 97
            |:|:|...|...|..|: |..|..|.......::|.... |:...:|:|.|..|..|..|..:||
Mouse   137 SKQSTPTGLSLPLSTSV-PDSAESGCSSCSTPLYDQGGPVEILSFLYLGSAYHASRKDMLDALGI 200

  Fly    98 THVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDS 162
            |.::|.:..|               |:....|    ::|...|:.|....|||.:|..|..||||
Mouse   201 TALINVSANC---------------PNHFEGH----YQYKSIPVEDNHKADISSWFNEAIDFIDS 246

  Fly   163 AISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDME 226
            ...:||::.|||..|:|||||..|||||...::...:|...|:.||. |.||..|:.||...:.:
Mouse   247 IKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQ 311

  Fly   227 L 227
            :
Mouse   312 V 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 52/157 (33%)
Dusp1NP_038670.1 DSP_MapKP 7..136 CDD:238723
DSPc 173..309 CDD:238073 52/154 (34%)
CDC14 188..313 CDD:225297 48/144 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.