Sequence 1: | NP_001285421.1 | Gene: | CG7378 / 32888 | FlyBaseID: | FBgn0030976 | Length: | 235 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038670.1 | Gene: | Dusp1 / 19252 | MGIID: | 105120 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 62/196 - (31%) |
---|---|---|---|
Similarity: | 91/196 - (46%) | Gaps: | 22/196 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 SEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGI 97
Fly 98 THVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDS 162
Fly 163 AISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDME 226
Fly 227 L 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7378 | NP_001285421.1 | DUSP3-like | 71..227 | CDD:350365 | 52/157 (33%) |
Dusp1 | NP_038670.1 | DSP_MapKP | 7..136 | CDD:238723 | |
DSPc | 173..309 | CDD:238073 | 52/154 (34%) | ||
CDC14 | 188..313 | CDD:225297 | 48/144 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |