DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and ZK757.2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_499190.2 Gene:ZK757.2 / 191421 WormBaseID:WBGene00014074 Length:294 Species:Caenorhabditis elegans


Alignment Length:164 Identity:47/164 - (28%)
Similarity:77/164 - (46%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRS---HKDC 132
            |.::.|.:|:...||...:...|.....:::                     |..|.|   |   
 Worm    14 CSQIRPYLYVSGLAALSPRVLSRFCVCINLI---------------------PGFRLSAPPH--- 54

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSA 197
             .:.:..|:.|..|||:|.::....|.|:.|....|:.|:.|.:|:|||||..:||:|...|.:.
 Worm    55 -MKVVHLPLQDNETTDLSPHWANVYKEIEEARKGAGRALLLCAMGISRSATFGIAYVMQYEKKTL 118

  Fly   198 VDAIRTVRMRRD-IRPNDGFLQQLADLDMELKRK 230
            .|:.:.|::.|: |.||.||.|||.||:.:|:.|
 Worm   119 HDSYKAVQLARNIICPNVGFFQQLIDLEQKLRGK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 45/159 (28%)
ZK757.2NP_499190.2 DSPc 14..148 CDD:214551 45/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.